PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.006G223300.1.p
Common NameSb06g029270, SORBIDRAFT_06g029270
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family HD-ZIP
Protein Properties Length: 790aa    MW: 85257.2 Da    PI: 5.5322
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.006G223300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox64.31.7e-20110166157
                           TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
              Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57 
                           +++ +++t++q++e+e++F+++++p+ ++r+eL+++lgL+  qVk+WFqN+R+++k+
  Sobic.006G223300.1.p 110 KKRYHRHTQHQIQEMEAFFKECPHPDDKQRKELSRELGLEPLQVKFWFQNKRTQMKN 166
                           688999************************************************995 PP

2START2031.3e-633055261206
                           HHHHHHHHHHHHHHHHC-TT-EEEE.....EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S.. CS
                 START   1 elaeeaaqelvkkalaeepgWvkss.....esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla.. 77 
                           ela +a++elv++a+++ep+W         e +n++e+   f+ + +     +++ea+r+s vv+m++a+lve+l+d++ q+ + +   
  Sobic.006G223300.1.p 305 ELAVTAMEELVRMAQLDEPLWNAPGldgsaETLNEEEYAHMFPGGLGpkqygFKSEASRDSSVVIMTHANLVEILMDVN-QYATVFSsi 392
                           57899****************987778888************665559999****************************.888888888 PP

                           ..EEEEEEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEE CS
                 START  78 ..kaetlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepk 157
                             +a tlev+s+g      galq+m+ e+q++splvp R+++fvRy++q  +g+w++vdvS+ds ++++    v +++++pSg+li+++
  Sobic.006G223300.1.p 393 vsRAVTLEVLSTGvagnynGALQVMSVEFQVPSPLVPtRESYFVRYCKQNADGSWAVVDVSLDSLRPNS----VLKCRRRPSGCLIQEM 477
                           88*****************************************************************97....8*************** PP

                           CTCEEEEEEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
                 START 158 snghskvtwvehvdlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                           +ng+skvtwvehv++++r++h++++ lv+sgla+ga++wv tl+rqce+
  Sobic.006G223300.1.p 478 PNGYSKVTWVEHVEVDDRSVHNIYKLLVNSGLAFGARRWVGTLDRQCER 526
                           ***********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466897.94E-2095167IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.0E-2295165IPR009057Homeodomain-like
PROSITE profilePS5007116.989107167IPR001356Homeobox domain
SMARTSM003893.5E-20108171IPR001356Homeobox domain
CDDcd000861.49E-19110168No hitNo description
PfamPF000464.3E-18110165IPR001356Homeobox domain
PROSITE patternPS000270142165IPR017970Homeobox, conserved site
PROSITE profilePS5084841.829296529IPR002913START domain
SuperFamilySSF559611.87E-35297528No hitNo description
CDDcd088751.93E-123300525No hitNo description
SMARTSM002344.3E-58305526IPR002913START domain
PfamPF018524.6E-53306526IPR002913START domain
Gene3DG3DSA:3.30.530.201.3E-5367522IPR023393START-like domain
SuperFamilySSF559612.7E-24547778No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009845Biological Processseed germination
GO:0009913Biological Processepidermal cell differentiation
GO:0048497Biological Processmaintenance of floral organ identity
GO:0048825Biological Processcotyledon development
GO:0005634Cellular Componentnucleus
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 790 aa     Download sequence    Send to blast
MMIPARHMPP MIVRNSAAAY GSSSALSLSQ PNLLDSQQQL QLQQALQQQH LLDQIPATTA  60
ESGDNMGRSG GGRGSDPLMG GDEFESKSGS ENVDGVSVDD QDPNQRPSKK KRYHRHTQHQ  120
IQEMEAFFKE CPHPDDKQRK ELSRELGLEP LQVKFWFQNK RTQMKNQHER HENSQLRAEN  180
EKLRAENMRY KEALSSASCP NCGGPAALGE MSFDEHHLRV ENARLREEID RISAIAAKYV  240
GKPMVSFPVL SSPLAGARPS PLDIGGGVGG AAAYGAVDMF GGGVAVDLLR GAVPQSDADK  300
PMIVELAVTA MEELVRMAQL DEPLWNAPGL DGSAETLNEE EYAHMFPGGL GPKQYGFKSE  360
ASRDSSVVIM THANLVEILM DVNQYATVFS SIVSRAVTLE VLSTGVAGNY NGALQVMSVE  420
FQVPSPLVPT RESYFVRYCK QNADGSWAVV DVSLDSLRPN SVLKCRRRPS GCLIQEMPNG  480
YSKVTWVEHV EVDDRSVHNI YKLLVNSGLA FGARRWVGTL DRQCERLASV MASNIPTSDI  540
GVITSTEGRK SMLKLAERMV MSFCGGVTAS AAHQWTTLSG SGAEDVRVMT RKSVDDPGRP  600
PGIVLNAATS FWLPVPPKRV FDFLRDESSR SEWDILSNGG VVQEMAHIAN GRDHGNCVSL  660
LRVNSTNSNQ SNMLILQESC TDASGSYVIY APVDVVAMNV VLNGGDPDYV ALLPSGFAIL  720
PDGPAGSNMQ GDGGVGSGGS LLTVAFQILV DSVPTAKLSL GSVATVNSLI ACTVERIKAA  780
VSGESNPQQ*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Sbi.208760.0panicle
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0538320.0BT053832.1 Zea mays full-length cDNA clone ZM_BFb0217B02 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002448563.10.0hypothetical protein SORBIDRAFT_06g029270
SwissprotQ0J9X20.0ROC2_ORYSJ; Homeobox-leucine zipper protein ROC2
TrEMBLC5YGI20.0C5YGI2_SORBI; Putative uncharacterized protein Sb06g029270
STRINGSb06g029270.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP79938147
Representative plantOGRP14515136
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G04890.10.0protodermal factor 2